Summary. Enzymes are catalysts that, within the mild conditions of temperature, pH, and pressure of the cells, carry out chemical reactions at amazing high rate. They are characterized by a remarkable efficiency and specificity. Substrates are the substances on which enzymes act.
<span>Depending on the severity, the bone would need to be placed back in it's original position. It would then have to be set in a cast, hard or soft. Making sure that the bones are in a comfortable position, helps the them heal quicker and gentler.</span>
Answer:
A. Carbon dioxide travels from the heart to the lungs in pulmonary arteries
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The biggest difference between prokaryotic and eukaryotic is that eukaryotic cells have a nucleus and prokaryotic cells do not.