its true............................................true
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The importance of human genetic research. ... 13.11 Human genetic research generates knowledge with the potential to improve individual and community health. Research can also reveal information about an individual's susceptibility to disease and hence about the individual's future health.
Explanation:
https://www.alrc.gov.au/publication/essentially-yours-the-protection-of-human-genetic-information-in-australia-alrc-report-96/13-the-regulation-of-human-genetic-research/the-importance-of-human-genetic-research/
Answer:
The importance of the AUG and UGA bases lies in the fact that the first one is a start codon and the second one is a stop codon, respectively (option a).
Explanation:
Codons or triplets are sequences of three nitrogenous bases, in the mRNA, that determine the synthesis of a specific amino acid.
- <em>AUG </em><em>is called the </em><em>initiation or start codon</em><em>, and is usually at the beginning of a peptide synthesis, in addition to encoding the amino acid methionine.
</em>
- <em>UGA</em><em> is a</em><em> termination or stop codon</em><em> found at the end of a petid chain when it is complete. UAA and UAG codons are also STOP or termination codons and, together with UGA, do not code for amino acids.</em>
The biological importance of start and stop codons is to initiate the synthesis of a protein and to stop the addition of amino acids when their size is adequate.