its a stimuli a memory is something you can choose to remember or to do
What are the species that are labeled a to e?
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: It's showing the change of the average temperature.
Explanation:
Answer:
Hox genes regulate sex determination in mammals.
-Hox genes regulate flower development.
-Hox genes encode transcription factors that respond to steroids.
-Hox genes encode transcription factors with a DNA-binding domain called a homeo box and regulate development of the vertebrate body plan
- Hox genes are transcription factors that bind to specific DNA sequels called homeodomains
and regulate development of the vertebrate body plan.
Hox genes are transcription factors that bind to specific DNA sequences called
homeodomains.
Explanation: