Answer:
Proteins range in molecular weight from 1000 to more than 1 million daltons (Da), but the folded size of a globular protein is not necessary correlated to its molecular weight. Proteins composed of about 250 amino acids or less often have a simple, compact globular shape. Larger globular proteins are usually made up of two or more recognizable and distinct structures, termed domains or modules. These are compact, folded protein structures that are usually stable by themselves in aqueous solution. Typical domain structures consist of hydrophobic cores with hydrophilic surfaces. Individual domains often possess unique functional behaviors and often perform unique functions within the larger protein in which they are found.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The results from the research suggest that a person who experiences auditory hallucinations that are localized in the expressive area of the brain is actually listening to his or her own thoughts. Since the problem is in the expressive area, this shows that the patient is only listening to the ideas his brain is already producing.
The answer is A and B.
Hope that helped you.
