1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
masya89 [10]
3 years ago
12

A pencil costs $0.45, an eraser costs $0.30, and a pencil sharpener costs $0.30. What is the cost of 3 pencils, 2 erasers, and 1

pencil sharpener?
Mathematics
1 answer:
alexandr1967 [171]3 years ago
3 0

Hi!

We know the prices of one pencil, one eraser and one pencil sharpener, which are $0.45, $0.30 and $0.30, respectively. Given that, we will find the cost of 3 pencils, 2 erasers and 1 pencil sharpener like this:

3 * 0.45 + 2 * 0.30 + 1 * 0.30 = 1.35 + 0.60 + 0.30 = 2.25

The cost of 3 pencils, 2 erasers and 1 pencil sharpener is $2.25.

Hope this helps!

You might be interested in
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
The height of a cable that runs between two supports on a suspension bridge can be modeled by a quadratic function () where is t
Murrr4er [49]

What is the vertex

Its vertex is at (36, -10)

Let us assume that the left edge of the cable is at the origin.

Since the cable is at its lowest height 10 feet halfway between the two supports, the y-coordinate of its lowest point is -10 ft and the x coordinate is 72 ft/2 = 36 ft.

So, its vertex is at (36, -10)

Axis of symmetry

The y-axis.

Since the cable is symmetric about its lowest point, the axis of symmetry is the y-axis.

Domain

The domain is (0, 72).

Since the minimum value of its x-coordinate is at the origin which is x = 0 and the maximum value is at the other support which is at x = 72 ft,

the domain is (0, 72).

Range

The range is (0, -10)

Since the minimum value of the y-coordinate is -10ft and the maximum value is at the origin y = 0,

the range is (0, -10)

x and y-intercepts

The x-intercept is (0, 72) and the y-intercept is (0, 0)

Since the cable is attached at the origin and at 72 feet away  from the origin at the other support, the x-intercept is 0 and 72 ft and the y-intercepts are 0 and 0.

So, the x-intercept is (0, 72) and the y-intercept is (0, 0)

Learn more about quadratic functions here:

brainly.com/question/10606041

5 0
2 years ago
-3x+3y=12<br> Y=x+4<br> Whats the soultion
lisov135 [29]

The system of equations has infinitely many solutions

<em><u>Solution:</u></em>

<em><u>Given system of equations are:</u></em>

-3x + 3y = 12 ------- eqn 1

y = x + 4 --------- eqn 2

We have to find the solution to the system of equations

We can use substitution method

Substitute eqn 2 in eqn 1

-3x + 3(x + 4) = 12

-3x + 3x + 12 = 12

-3x + 12 = -3x + 12

If we have terms with same terms on both sides of equal sign, then we have infinitely many solutions

Thus the system of equations has infinitely many solutions

5 0
3 years ago
Jake has $11 left in his pocket. he spent $3 on a bus ticket, $5 on lunch, and $5 on a movie. how much money did he have at the
KATRIN_1 [288]
$24 if it is at the beginning of the day and he is left with $11, and if he spent $13, then 11+13=24
4 0
3 years ago
Read 2 more answers
Write each percent as a fraction in simplest form 16%
padilas [110]

Answer:

16% is 4/25 15% is 3/20 14% is 7/50 13% is 13/100 12% is 3/25 11% is 11/100 10% is 1/10 9% is 9/100 8% is 2/25 7% is 7/100 6% is 3/50 5% is 1/20 4% is 1/25 3% is 3/100 2% is 1/50 and 1% is 1/100

Step-by-step explanation:

If you want to find a percent you have to put that number over 100 so say I was looking for 20% you would put 20/100 then you would reduce by dividing if they can and both can be divided by two so it would then be 10/50 then those can be divided by 10 so it would be 1/5

4 0
3 years ago
Other questions:
  • The interior angles of a triangle measures 180?<br> True or false
    5·1 answer
  • Which of the following sets of ordered pairs represents a function
    11·1 answer
  • Find the cosine of angle B.
    14·1 answer
  • A triangle with vertices at (0,4), (3,5), and (2, -l) is rotated 90 degree counterclockwise about the origin. What are the verti
    15·1 answer
  • Round 80417.0858163 to the nearest hundred.
    13·2 answers
  • PLEASE YALL I need HELP ASAP PLEASE PLEASE PLEASE I WILL MARK YOU AS BRANLIEST IF CORRECT
    15·2 answers
  • Robin draws a square with a measure of (x + 2) inches on each side. The perimeter of each square is 96 inches. The equation belo
    6·2 answers
  • Math work pls help :)​
    9·1 answer
  • Can someone please answer this for me please??
    6·1 answer
  • 73.8 is what percent of 90?<br> Please i need help asap!
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!