A single species that has evolved into several different forms that live in different ways has undergone "b. convergent evolution" since the multiple "divergent" species are seen to "converge" into a single species if you go back far enough in time.
Answer:
Sympatric speciation.
Explanation:
Sympatric speciation is a type of speciation that occurs when 2 types of groups of the common species live in the common geographic location, but they grow differently until they can no longer interbreed and are known as different species.
This speciation can occur in different types of species such as bacteria, the apple maggot fly, and cichlid fish, but it is difficult to tell when this speciation is happening or has occurred in nature. There are four types of speciation occurs:
1) Symmetric
2) Allopathic
3) Parapatric
4) Peripatric.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Spirogyra is a genus of green algae that belong to the order Zygnematales. These free-flowing, filamentous algae are characterized by ribbon-shaped chloroplasts that are arranged in a helical manner inside the cells. So the name is derived from the spiral arrangement of chloroplasts in these algae.
Explanation:
Answer: its mitosis
Explanation:
Cell division by mitosis occurs in all human body cells except the gonads (sex cells). During mitosis, the DNA is exactly copied and a new daughter cell created with the same number of chromosomes as the parent cell, ie 46.