Answer:
Explanation:
En física, la materia es todo aquello que se extiende en cierta región del espacio-tiempo, que posee energía y está sujeto a cambios en el tiempo y a interacciones con aparatos de medida. Se considera que es lo que forma la parte sensible de los objetos perceptibles o detectables por medios físicos.
Etimológicamente, proviene del latín materia, que significa «sustancia de la que están hechas las cosas» y que también alude a la «madera dura del interior de un árbol»;1 la palabra está relacionada con māter («origen, fuente, madre»)2 y se corresponde con el griego hyle3 (de hylos: «bosque, madera, leña, material»)45 que es un concepto aristotélico de la teoría filosófica del hilemorfismo.6
El uso moderno del término va más allá de la noción clásica de sustancia, y los físicos denominan materia a cualquier entidad cuya presencia en una cierta región del espacio-tiempo conlleva que el tensor energía-impulso para dicha región es diferente de cero.
Answer:
In the course of evolution mammals are the animals which are evolved recently as compared to other groups such as fish, amphibians, or reptiles.
In addition, fur or hairs on body, mammary glands, middle ear bone, warm-blood, et cetera are the characteristics of mammals.
These characteristics were evolved during the course of evolution; they were not present in ancestral organisms.
However, tail, gill pouches, et cetera are characteristics of our ancestral groups. Thus, characters can be sometimes observed in mammals.
But mammals characteristics can not be observed in organisms which were evolved before mammals such as fishes, amphibians, reptiles, et cetera.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer is abdominal cavity ! hope this helped you :)
Answer:
The correct answer is option 3. removal of hydrogen atoms from lactic acid.
Explanation:
In anaerobic conditions, it ferments to generate lactic acid. It is two way or reversible process in which oxidation of lactic acid produces pyruvic acid and NADH.
This process involves the removal of hydrogen atoms from the lactic acid and produces NADH and H⁺ in the presence of lactate dehydrogenase enzyme and convert into pyruvic acid.
Thus, the correct answer is option 3. removal of the hydrogen atoms from lactic acid.
