The answer is: "Communication".
_______________________________
Communication <span>is the sharing of meaning by sending and receiving symbolic cues.</span>
Answer:
kinda
Explanation:
amosc 2eifjdweijffffffffffffffffffffffffffffffffwijisdjcivivheivhichirhienvdcinrqwfnciwdmkvfbgt'rfejqbrhmtuj6k54y53r3fqecvgbnmhjr,
The correct answer is:
B. mistaken identity
Explanation:
Twelfth Night is a story about transgression. Shakespeare plays with the ideas of love, confused identity, and social class in this parody. The play really contains three plotlines that come usually in the final scene. The plotlines are held collectively by the character of Feste, the Fool, who can cross social boundaries because of his freedom from working, the right of an "entitled Fool.
"For whom the bell tolls" is a line from a poem by John Donne (pronounced like "Dunn") written in the early 1600s. Hemingway used a line from the poem as the title of a novel he wrote in the 20th century.
The poem goes like this (the copyright is in the public domain):
<span>No man is an island,
Entire of itself.
Each is a piece of the continent,
A part of the main.
If a clod be washed away by the sea,
Europe is the less.
As well as if a promontory were.
As well as if a manor of thine own
Or of thine friend's were.
Each man's death diminishes me,
For I am involved in mankind.
Therefore, send not to know
For whom the bell tolls,
It tolls for thee.</span>
<span>Assuming the underlined part of the sentence is the word animals', the correct answer is A. noun phrase. It the center of the phrase, or rather, the most important part of a phrase, is a noun, such as in this case, then the whole phrase is called a noun phrase. It can function as a subject, object, or take some other functions in a sentence.</span>
