Answer:
talia looks sluggish and refuses to eat meals prepared for her
Explanation:
this effects her physically rather than mentally
hope this helps
Answer:
Production of bile= which Help carry away waste and break down fats in the small intestine during digestion.
production of certain proteins for blood plasma.
production of cholesterol and special protein to help carry fats through the body
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
Answer:
I do not think it is possible. You can loose weight by not consuming anything (not receiving proper nutrition) and it can be damaging to the body. Also without the proper nutrients is would be hard to maintain fitness because you would lack energy. If you don't have nutrition your hair,nails,bones and skin with become weak and you will feel drained and tired all the time. Yes you could lose weight but your body wouldn't be healthy.
Explanation:
The Hardening and narrowing of the arteries caused by a buildup of cholesterol plaques is known as [ atherosclerosis ]
