<h2>Answer:</h2><h3>Lilies do best in a position of full sun, ideally with their roots in rich and fairly moist, yet free-draining soil or compost. Grow oriental lilies in acidic soil or ericaceous compost, and Asiatic lilies in neutral to alkaline soil or multi-purpose compost and not in gardens because most Garden soils are made from three main components: clay, sand and silt. The ideal soil (or loam) has equal amounts of all three, making a fertile soil that is free draining and easy to dig.Which are nothing but making the sand more rougher.So therefore those lillies will not grow in the garden soil and that is the reason why the lillies never grew</h3><h3 />
This is because the cells we need for reproduction need to be genetically different from those of the rest of the body.
Cellular reproduction
When a mother cell divides into two or more daughter cells, this process is known as cell division. Cell division frequently takes place as a component of a longer cell cycle. There are two different types of cell division in eukaryotes: a vegetative division (mitosis), in which each daughter cell inherits the genetic makeup of the parent cell, and a reproductive division (gametogenesis), in which the number of chromosomes in the daughter cells is cut in half to produce haploid gametes (meiosis). In cell biology, the process of mitosis, during which replicated chromosomes are split into two new nuclei, is a stage of the cell cycle. The number of chromosomes is maintained in the genetically identical cells produced by cell division.
To learn more about cellular reproduction refer here:
brainly.com/question/28013772
#SPJ4
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
