1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
jeka94
2 years ago
7

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Health
1 answer:
Tatiana [17]2 years ago
7 0

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

You might be interested in
How do you increase IRON in your diet? Choose all that apply.
Alina [70]
The answer is C) All of the above are correct. Eating meat like deer can get iron in your diet because Deer eat plants. Plants have Iron in them. And a good amount. Eating green leafy vegetables is good because like I said, Leafy vegetables carry a good amount of Iron. Taking an Iron supplement is also good, because it's iron. A straigth way to get it into your system.
3 0
4 years ago
Read 2 more answers
Which of the following produces bile, which helps with the digestion of fat?
morpeh [17]
D. liver is the answer.
5 0
3 years ago
Read 2 more answers
I’m starting not to be able to fit my clothes so How do I gain weight fast?
malfutka [58]

Explanation:

one of the things that you can do can be drinking soemething(like a healthy protein smoothie) with protein powder but also doing like weights or pushups,etc

5 0
4 years ago
Passive communicators do all of the following EXCEPT: A. do not make eye contact B. tend to speak apologetically C. stand up for
erastova [34]
Passive communicators do all of the following except: 
C. Stand up for themselves when needed.
This is true because the definition of passive is "accepting without interferance."
7 0
3 years ago
Read 2 more answers
The use of rules to control behavior:
rjkz [21]
Answer: B punishment
7 0
3 years ago
Read 2 more answers
Other questions:
  • Exposure to ultraviolet light darkens the skin by stimulating production of
    10·1 answer
  • One gram of carbohydrate contains ____ calories.<br> A. 9 B. 7 C. 5 D. 4
    5·2 answers
  • In the Category column, classify the following activities as either health promotion or health protection. If any of these actio
    15·2 answers
  • Take notes below in the table to help you classify what the categories mean and examples of each kind of peer pressure. You may
    11·1 answer
  • In early development bone tissue is made mostly of
    11·1 answer
  • What is the BEST strategy to improve flexibility in your legs and back?
    14·2 answers
  • Why are checking references in background check important when considering any staff member?
    8·1 answer
  • Please help i may fail the class.
    15·2 answers
  • Morphine, opium, codeine, and heroin are examples of the following group of
    6·2 answers
  • The practice of embalming began as a science enabling those studying anatomy the opportunity for detailed investigation.
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!