1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
jeka94
2 years ago
7

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Health
1 answer:
Tatiana [17]2 years ago
7 0

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

You might be interested in
Antianxiety medications such as valium and xanax, work by _____ in the brain.
kherson [118]
Anitianxiety medications such as valium and xanax, work by increasing GABA activity in the brain.
I hope this helps.
4 0
4 years ago
A 15-year-old boy visits his primary care physician's office with fever, headache, and malaise, along with complaints of pain on
ruslelena [56]

Answer:

The nurse recognizes that this client most likely has "Mumps"

Explanation:

Primary signs of mumps comprise fever, headache, anorexia, and malaise. Within 24 hours, discomfort on eating and an "earache" happens. Once the child ideas to the place of the earache, however, he points to the jawline just in visible of the ear lobe, the site of the parotid gland. By the next day, the gland seems inflamed and feels tender; the ear develops expatriate upward and backward. Boys may also grow testicular pain and inflammation (orchitis). None of the other conditions listed matches the symptoms indicated.

7 0
3 years ago
PLEASE HELP?!?!? IM CONFUSED WITH THIS AND ALSO EXPLAIN UR ANSWER WHY!!!
muminat
Call 911 would be the best thing to do.
7 0
3 years ago
All the participants in the study are given information regarding the benefits of a healthy diet. According to the cognitive dis
bixtya [17]

Answer: C) Obese participants will question the validity of the information provided.

Explanation:

According to the theory of the cognitive dissonance, when the attitudes of the individuals are incongruent to the behavior, this leads to the cognitive dissonance. To remove the cognitive dissonance, the person can either change the attitude or the behavior or the person can adjust the attitude in accordance with the behavior.

Thus obese participants are likely to question about the validity of the information regarding the healthy diet. This is because of the fact that their attitude is against their behavior of eating hence, they may not obtain the benefits of the healthy diet.

8 0
4 years ago
Which of the following is NOT an example of how your environment could have an influence on your food choice or eating habits?
Anettt [7]

Answer:

the answer is d since you don't like either so you wouldn't eat them and it wouldn't effect you

Hope This Helps!!!

8 0
3 years ago
Read 2 more answers
Other questions:
  • Jocelyn loves to dance. She does jazz dance every single day for at least an hour and recently added tap. Which of the following
    15·2 answers
  • Sara, age 40, has diabetes and is now experiencing anhidrosis on the hands and feet, increased sweating on the face and trunk, d
    5·1 answer
  • What is the best percentage of protein for weightloss?
    9·1 answer
  • To assist in nutrition screening in the community, the local senior center has developed a screen to help them identify individu
    15·1 answer
  • Which is an example of paralanguage
    12·2 answers
  • The _____ dimension of the Myers-Briggs Type Indicator (MBTI) assessment concerns an individual's attitudes toward ambiguity and
    7·1 answer
  • Which method of measuring weight involves comparing a person's weight and height?
    8·2 answers
  • Give 3 reasonable facts that prove the difference of type 1 diabetes and type 2 diabetes ​
    8·1 answer
  • Which of the following is an appropriate time to use anti-septic handle
    7·1 answer
  • How long did it take to develop the smallpox vaccine?
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!