1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
jeka94
1 year ago
7

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Health
1 answer:
Tatiana [17]1 year ago
7 0

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

You might be interested in
What items would you include in a first aid kit?
Komok [63]
You can add band aids, alcohol pads, and gauze.
8 0
3 years ago
Read 2 more answers
Which of the following statements about cell organelles is NOT true?
mafiozo [28]

Answer: C. The nucleus in an animal cell has a different primary function than in a plant cell.

Explanation: Animal and Plant cells are both eukaryotic cells. They have the same function :)

3 0
2 years ago
Peter has been seeing a counselor for problems in his sexual life. Peter’s counselor referred him to an urologist to treat his p
BlackZzzverrR [31]
Peter has been seeing a counselor for problems in his sexual life. Peter’s counselor referred him to an urologist to treat his problem. Which disorder is most likely to be the cause of Peter’s problems? <span>-erectile dysfunction or urinary problems</span>

8 0
3 years ago
Read 2 more answers
Please help me full out the ones i highlighted in red. i have to turn it in soon!!
Goryan [66]

Answer:

Contract

Lower

Relax

Increase

7 0
3 years ago
Read 2 more answers
Serving others can give you a break from focusing on your personal problems.
hjlf

Answer:

true

Explanation:

7 0
2 years ago
Read 2 more answers
Other questions:
  • The medical term that refers to extremity blood vessels is:
    8·2 answers
  • What is the proper sequence for process of keeping food safe
    6·1 answer
  • Select all that apply. What are the benefits of stretching? makes you stand straighter prevents leg cramps strengths the heart m
    14·2 answers
  • Describe at least two ethical issues surrounding the development of personalized medicine.
    14·1 answer
  • How can individual sports positively influence social health?
    13·1 answer
  • The endocrine gland most responsible for growth is the:
    9·1 answer
  • 1. Ultimate Kickball differs from regular kickball because____________.
    9·1 answer
  • What are the four classifications of birth control
    9·2 answers
  • *Will award brainliest if correct answer is given!*
    5·2 answers
  • Essay on the FDA Panel Backs Removal of Unproven Pregnancy Drug
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!