Functional and economically most important mineral in nutrition of layers
is calcium, primary because of egg production, i.e. forming of the egg shell.
Answer:
this is assuming brown eyes are dominant
6a 9/16
b.3/16
c 3/16
d. 1/16
Explanation: there might be an easy way to calculate it but I draw it out and use the dominance and lettering and just count I used slide 5 as a starting point
to do more than this would require seeing the square on slide 1 they are referring to as it is specific to 2 parents
4. a Bb and bb
b. bb and bb
5. BBEE BBEe BbEEBbEe
BBEe BBee BbEe Bbee
BbEE BbEe bbEE bbEe
BbEe Bbee bbEe bbee
2 a Bb
b Brown hair
c. Bb and brown hair
d. blonde hair
e. BB
3. A50%
c. 50%
25%
75%
25%
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The only answer that could be considered an advantage is C. Increasing the amount of crops harvested.