1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
beks73 [17]
2 years ago
11

You observe two breeding female fish of the same species. One female lays 100 eggs and the other female lays 1,000 eggs. Which o

ne of the following outcomes is most likely, given the limits of fitness trade-offs? A. The female laying 1,000 eggs breeds more often than the female laying 100 eggs. B. The female laying 100 eggs lives longer than the female laying 1,000 eggs. C. The eggs from the female laying 1,000 eggs have larger yolks than the yolks of the eggs from the female laying 100 eggs. D. The female laying 100 eggs is larger than the female laying 1,000 eggs.
Biology
1 answer:
makvit [3.9K]2 years ago
8 0

The correct option is (C) The eggs from the female laying 1,000 eggs have larger yolks than the yolks of the eggs from the female laying 100 eggs.

The sequence of survival and reproduction events characteristic for a member of the species is known as the life history of the species (essentially, its lifecycle).

  • Natural selection drives the evolution of life cycle patterns, which are a "optimization" of trade-offs between growth, survival, and reproduction.
  • The quantity of eggs laid by female fish during reproduction may vary, but it doesn't provide accurate information if the eggs from the female that lays less eggs have more yolk.
  • Given that the fitness factor remains the same, the quantity of eggs laid does not necessarily correspond to the amount of yolk in the eggs.

Learn more about the Life history with the help of the given link:

brainly.com/question/28192982

#SPJ4

You might be interested in
What is the most important mineral in a layer's diet and why? Has to do with chickens
lord [1]
Functional and economically most important mineral in nutrition of layers
is calcium, primary because of egg production, i.e. forming of the egg shell.
4 0
4 years ago
NEED HELP FOR 100 POINTS AND BRAINLIEST PLEASEEE
Margarita [4]

Answer:

this is assuming brown eyes are dominant

6a 9/16

b.3/16

c 3/16

d. 1/16

Explanation: there might be an easy way to calculate it but I draw it out and use the dominance and lettering and just count I used slide 5 as a starting point

to do more than this would require seeing the square on slide 1 they are referring to as it is specific to 2 parents

4. a Bb and bb

b. bb and bb

5. BBEE BBEe BbEEBbEe

BBEe BBee BbEe Bbee

BbEE BbEe bbEE bbEe

BbEe Bbee bbEe bbee

2 a Bb

b Brown hair

c. Bb and brown hair

d. blonde hair

e. BB

3. A50%

c. 50%

25%

75%

25%

6 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Which of the following is an advantage that a farmer would see when using a genetically engineered ?
IRISSAK [1]
The only answer that could be considered an advantage is C. Increasing the amount of crops harvested.
4 0
3 years ago
Read 2 more answers
The illustration shows structures into animals these are known as??? helpp
bazaltina [42]
D. Homologous structures
5 0
3 years ago
Other questions:
  • Which processes lead to most genetic variation in sexually reproducing organisms? select all that apply. select all that apply.
    5·2 answers
  • Why are advantageous traits more likely to be passed onto offspring
    9·1 answer
  • Meiosis produces four new cells with ______ the chromosomes as the parent cell. two-thirds one-half one-quarter one-third
    9·1 answer
  • Hot water from a power plant is flowing into a river and killing the aquatic life. What type of pollution is causing this situat
    12·2 answers
  • A new island forms due to an underwater volcano. Birds from the mainland colonized the island. This is an example of
    10·2 answers
  • Which is a step of the scientific method in environmental science? A. Testing a hypothesis B.Carrying out research C.Collecting
    5·1 answer
  • How is a bacterium different from ours
    14·2 answers
  • Note this isnt for school!!
    10·2 answers
  • What are smaller subunits called
    9·1 answer
  • Enzymes end in ase or in. what substances/ macromolecules do you think the following enzymes break down?
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!