The answer should be rectum.
<span>The two sentences that accurately describe the girls' experience with heat transfer are "Camille heats a rock in the campfire for 30 minutes, and then removes it with tongs. She greases the rock and lays the bacon strips directly on it." By heating the rocks in the campfire and laying the bacon on the rocks, the girls transferred the heat from the fire to the rocks, and the heat from the rocks to cook the bacon.</span>
A zoonosis (zoonotic disease or zoonoses -plural) is an infectious disease that is transmitted between species from animals to humans (or from humans to animals).
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
