13
Explanation:
We will divide the total number of the teachers (246) in the auditorium with the maximum number of seats per row (18) to determine how many rows are completely filled;
246/ 18 = 13.6667
We are only interested in rows that are completely filled which is the whole number;
= 13
Learn More:
brainly.com/question/13235411
brainly.com/question/2352952
#LearnWithBrainly
Answer:
radiant. energy into chemical energy
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: I got it :)
Explanation:
Domain, Kingdom, phylum, class, order, family, genus, and species.
The root word of the word Microvasculer is MICRO