1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Fynjy0 [20]
3 years ago
10

Can someone please describe the role of fermentation in maintaining ATP and NAD+ levels? I cant fully grasp the concept. Answer

ASAP please!!!!
Biology
1 answer:
Solnce55 [7]3 years ago
4 0
Fermentation is the process by which a carbohydrate molecule is broken down into alcohol and carbon dioxide in the absence of oxygen. During this process, two molecules of ATP is produced. In the absence of oxygen, pyruvate formed from glycolysis will undergo fermentation process. During the process of fermentation, NADH from glycolysis will be converted back to NAD+. This is necessary in order for glycolysis to continue. Thus, fermentation regenerate more NAD+ and only a few molecule of ATP.
You might be interested in
Some species form social groups only with members of the same gender. For example, elephants form groups with only females and t
Ostrovityanka [42]

Answer:

When the females tend to form a solitary group, the adult males have an advantage of mating with females in different social groups thus enhancing on the productivity of the species.

Explanation:

When both the sexes of the species tend to make a group, the males and the females of the group have to mate with the members of that particular group and hence the males have restricted mating options which reduce the size of the herd. When the females have a separate social group, the males can mate with the members of different groups and raise the herd size in a short period of time. This helps in the increase in the population size and also helps in avoiding inbreeding depression which happens among small grouped animals.

5 0
3 years ago
Read 2 more answers
Which would be a direct effect caused by habitat fragmentation?
Sonja [21]

Answer:

The answer is A

Explanation:

The road fragmented the habitat and now the turtles are not able to breed

6 0
3 years ago
Water is less dense in liquid form then in?
dedylja [7]

Answer:

solid form..............

3 0
3 years ago
Please help I can’t figure this out
Ilia_Sergeevich [38]

Answer:

Photosynthesis is the process in which cells use carbon dioxide and water to make glucose in the presence of sunlight.

Respiration is the process in which glucose molecules are utilized to release energy in the form of ATP.

Explanation:

Ans1- Respiration in cells occurs in mitochondria.  Cells gain energy in the form of ATP. Conversion of glucose in the form of ATP is known as cellular respiration.

Cellular respiration can take place either in presence of oxygen(aerobic respiration) or in absence of oxygen(anaerobic respiration ).

Before entering into cellular respiration glucose molecule has to be converted into pyruvic acid. This process in known as GLYCOLYSIS.

<em><u>Anaerobic respiration</u></em> occurs in mitochondria when oxygen is not present. It is known as fermentation.It is not effective process to produce ATP from glucose as in this process only 4 ATP can be released.  

<u><em>Aerobic respiration</em></u> occurs in mitochondria in presence of oxygen.  This is effective pathway to gain ATP as it releases 36 ATP from 1 glucose molecule.

Ans2- All cells which has photosynthetic pigments are able to use photosynthesis. Example- Blue green algae, cynobacteria etc.

Ans3- We can see different shades of green colors of plants and leaves because of different types of chlorophyll present in plant. Chlorophyll are of 6 types in plant. Their types are based on the lights they absorb. Two main types of chlorophylls are chl a and chl b.

Ans4- Both plant and animal cells have mitochondria. In plant also they need energy. To get ATP from breakdown of glucose respiration is occur in plant also.

Ans5-In photosynthesis glucose is formed from water and carbon di oxide. 6 carbon dioxide and 6 molecules of water are used to make 1 molecule of glucose. Water and carbon di oxide are reactant in this process.

Ans6 -  Cells without oxygen can burn glucose to release energy. This process is known as Anerobic respiration/ fermentation. But the outcome of energy is lower than aerobic respiration. ( ANS1)

Ans7- In the process of photosynthesis reactants are water and carbon di oxide. Oxygen produced released in the form of gas along  with carbon di oxide.

Ans8- The enzymatic reaction of respiration occurs in mitochondria. Krebs cycle occurs in the matrix of mitochondria.( ETC electron transport chain) to release ATP occurs in cristae of inner membrane of  mitochondria.

Ans9- Plants make glucose through photosynthesis . In  presence of sunlight plants use carbon dioxide and water to make sugar.

6 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • What monomers are found in dna and rna
    6·2 answers
  • Explain the main difference between exponential and logistic growth
    12·1 answer
  • Please help me ASAP!!!
    6·1 answer
  • In ocean acidification, dissolving co2 gas ________ the ph of the ocean.
    7·1 answer
  • Our Sun is all of the following EXCEPT ____.
    12·2 answers
  • What abiotic components would most likely change in a shallow ocean ecosystem during upwelling?
    11·1 answer
  • According to the RNA World hypothesis, which of these tasks was accomplished by early RNA, but is not generally accomplished by
    5·1 answer
  • What is the basic unit of life​
    7·2 answers
  • the nazca seafloor plate pushes into the south american continental plate. what is the most likely result
    15·1 answer
  • Soil erosion can be reduced by
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!