Answer:
Vultures, Hyenas, Ants, Bacteria that's all i got really
Explanation:
All of these either eat remains or break down remains of a decomposing animal and in doing so, speed up the process of the decomposing.
Answer:
It occurs to create innovation in the existing technology.
Explanation:
A technological advancement is an attempt to develop current materials, devices, products or processes by further understanding of science. technological advancement provides innovations of existing technology or formation of new technology in order to better the life style and make easier our work. If the technological advancement did not occur, we are unable to increase efficiency of various instruments and machines.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
While stress is a type of pressure given by force acting per unit area. Strain is the ratio of change in length and total length when stress occurs. Ratio of stress and strain gives Young's Modulus. The curve between stress and stress is linear as long as they are proportional to each other.
