Answer:
Mitochondrial proteins enter the organelle through channels formed by membrane proteins present in its inner and outer membranes.
Explanation:
All the biological membranes have lipid bilayer with the non-polar core that does not allow entry of charged and large substances. Mitochondrial proteins are synthesized in the cytosol and the unfolded proteins bind to the chaperons that deliver them to the receptors present in the outer mitochondrial membrane.
The receptor moves the protein to the membrane channels formed by integral membrane proteins of inner and outer mitochondrial membranes. The proteins enter the intermembrane space and are targeted to the inner membrane through channels while chaperons are left outside only.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
D. Inhibits the degradation of 2,3-BPG, thereby increasing its concentration in erythrocytes
Explanation:
A pharmaceutical company trying to develop a drug that improves tissue oxygenation by increasing the percentage of oxygen that is released from hemoglobin during its passage through the capillaries of extrapulmonary tissues. This drug, it is hoped, would become a popular doping agent for athletes.This means that the company should try a drug that Inhibits the degradation of 2,3-BPG( 2,3-Bisphosphoglycerate) , thereby increasing its concentration in erythrocytes
<span>tRNA contain an anticodon,and carries the desired amino acid to ribosome for addition to the polypeptide chain.</span>
