<span>D) Both are incompletely dominant
Hope this helps!</span>
Answer:
As the name suggests, proteases will be the enzymes which will catalyze the reactions of proteolysis. Proteolysis can be described as the process of breaking proteins into amino acids and simple peptide bonds.
DNases will catalyze the reactions for breaking down or degrading DNA. The DNase does this by breaking the phosphodiester bonds present in the backbone of the DNA.
RNases will be the enzymes which will catalyze the breaking of RNA molecules.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer would be 12 hope this helped
Answer:
D
Explanation:
Many animals influence and contribute to ecosystem services. As pollinators, how do bees ultimately contribute to direct ecosystem services? (1 point)
O Bees pollinate plant species that contribute to the carbon cycle.
O Bees pollinate plant species that humans admire in nature.
Bees pollinate plant species that produce oxygen that humans need.
O Bees pollinate plant species that produce food.
