Answer:
Intermediate Product Accumulation
Explanation:
If one of the crucial enzyme say B is mutated in the process of normal product formation, then the reaction will not proceed further from that point and accumulation of an intermediate product in the cell takes place. The mutation in the enzyme could be environmental or genetic but it will surely alter the enzyme functioning. In the end, the damage malfunctioning cell will be removed using the process of apoptosis.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The Big Bang Or Big Bang Theory is the theory scientists say how our universe started scientists say this occurred 13.7billion years ago
28 find that the cell spends in prophase (number of cells in prophase divided by the total # of cells (36) multiplied by 100)
Face Muscle
Reasoning- Right by the Jaw of the face where the muscles of mastication is.
