Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The periodic table can tell you. Hope this helps!
Answer:
Viruses are not living things.
Answer: No.
Explanation:
Viruses are complicated assemblies of molecules, including proteins, nucleic acids, lipids, and carbohydrates, but on their own they can do nothing until they enter a living cell. Without cells, viruses would not be able to multiply.
Answer:
D. Aids
Explanation:
Aids is one of the most deadliest diseases in the world. When you contract aids, it's designed to infect the cells that try to destroy it, it's a whole zombie apocalypse in your body and you don't even know it.
It attacks and weakens the immune system, and our immune system defends our bodies against infections, but HIV is extremely strong and it over powers the system, I'm not sure if there's an immune system strong enough to fight HIV or aids.
Answer: The impact of the colliding plates can cause the edges of one or both plates to buckle up into a mountain ranges or one of the plates may bend down into a deep seafloor trench.
Explanation: A chain of volcanoes often forms parallel to convergent plate boundaries and powerful earthquakes are common along these boundaries.
