1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ICE Princess25 [194]
3 years ago
9

Healthy environment support healthy & happy life​

Health
1 answer:
Shkiper50 [21]3 years ago
3 0

Answer:

yes healthy environment support healthy & happy life

You might be interested in
The most important step for preventing cardiovascular disease is to live a healthy lifestyle. Please select the best answer from
jok3333 [9.3K]

the answer is T. Always live a helathy lifestyle

5 0
3 years ago
Read 2 more answers
Suzie is a quiet and reserved person. She has a hard time fostering close relationships. She politely declines invitations to lu
MariettaO [177]
An introvert, because she likes to keep to herself.
5 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
The nutrient that provides 4 calories per gram and is needed to build and repair body tissue is
Colt1911 [192]
The nutrient that provide 4 cal per gram that is needed to build and repair body tissue is Protein
3 0
3 years ago
Does anyone want t o be friends?
TiliK225 [7]

Answer:

yes

Explanation:

5 0
2 years ago
Read 2 more answers
Other questions:
  • Gateway drugs are normally not addictive
    9·2 answers
  • Are there enough servings in this container to reach 100% of the recommended daily value for vitamin c?
    15·1 answer
  • How do advertisements you see on television or the Internet influence you to want to buy a certain
    8·1 answer
  • In a laboratory, smokers are asked to "drive" using a computerized driving simulator equipped with a stick shift and a gas pedal
    5·1 answer
  • Melissa: You know, I've been thinking a lot about where to go to college lately.
    6·1 answer
  • The nine essential amino acids are...
    7·1 answer
  • Why do we need the follow my plate guidelines?
    6·1 answer
  • To qualify for the Medicaid program,
    12·1 answer
  • What causes tuberculosis
    13·2 answers
  • a 14-year-old patient requests birth control pills from you and asks that you not tell her parents. what would you do?
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!