1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Oksi-84 [34.3K]
3 years ago
10

List three types of evidence that plants existed on Antarctica.

Biology
1 answer:
Advocard [28]3 years ago
5 0

Pollen , coal and stems  are evidences that plants existed in Antarctica.

Explanation:

  • Pollens being highly resistant to temperature changes due to the presence of sporopollenin must have remained preserved in ice covered continent of Antarctica.
  • Pollens are reproductive units of Plant that suggest existence of plants in the Ice covered land.
  • Coal is formed as the fossilization of plants under anaeorobic conditions and high pressure. thus, this also suggest the existence of plants.
  • Stems are plant parts thus clearly is an evidence that plants existed there.
You might be interested in
Which organism is considered to be the simplest of protist given its unicellular structure and ability to change its shape in re
Artist 52 [7]

The simplest form of protist based on its simple cell structure and ability to change shape in response to external disturbance would be amoeba.

<h3>Amoeba</h3>

Amoeba is a unicellular organism that belongs to the division of living organisms known as protists.

Amoeba can be found in freshwater environments such as ponds, moist soils, lakes, etc. The cell contains important organelles such as the nucleus, contractile vacuole, etc.

A typical amoeba cell has no definitive shape but changes according to different environmental stimuli.

More on amoeba can be found here: brainly.com/question/2005112

3 0
3 years ago
ANSWER ASAP PLS
Svetach [21]

Answer:

All groups.

Explanation:

if small fish, insects, ducks, snails, etc don't have food they will decrease in population and starve the organisms above them in the feed web, like a domino effect.

8 0
2 years ago
How are the chicken wing and human arm similar, different, and how they are adapted to allow the organism to survive in their en
saw5 [17]
They share similarities in their tissue and cartilage. Both humans and chickens have epithelial tissue, muscle tissue and connective tissues; as well as cartilage to support the joints between bones. The bone structure is similar as well. Both animals have a humerus, which connects the shoulder and radius. Unlike humans, chickens can't move their metacarpals. Chicken bones are also hollow, making them lighter and more built for flight. Our arms are made more for grabbing, lifting and picking things up. 
Hope this helps!
5 0
4 years ago
Viruses can infect bacteria as well as other organisms. What does the virus inject into the bacteria cell?
UNO [17]
Well viruses inject their RNA or DNA into a cell, so assuming they also inject their RNA or DNA into a bacteria to reproduce, then they basically treat the bacteria cell like any other cell..
4 0
3 years ago
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
Other questions:
  • How are a coconut seed and a watermelon seed most alike?
    10·1 answer
  • Some animals, but not humans, have an organ called a gizzard located near the top of their digestive tract. This organ is small
    12·1 answer
  • Which statement is true for single-celled organisms?
    9·2 answers
  • Water is a polar molecule
    10·2 answers
  • What are three types of muscles tissue found in the human body
    10·1 answer
  • WHICH IS STONGER SSJB KAIO-KEN OR SSJB EVOLUTION!<br><br> P.S. THIS IS MY HMWK DONT ASK WHY
    7·1 answer
  • Long bones have a distinctive __ that makes up most of the bone's length and is composed of compact bone.
    8·1 answer
  • Colorblindness results from
    6·2 answers
  • Gluconeogenesis is a form of ___. Select one: a. metabolism b. catabolism c. anabolism d. hydrolysis
    13·1 answer
  • The rugosity of a coral reef results in increased water turbulence relative to adjacent sandy benthos
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!