Answer:
1. Muscle Fibers
2. Bones
3. Joints
Explanation:
Muscle tissue is made of muscle fibers. The plasma membrane of a muscle fiber is called sarcolemma while its cytoplasm is known as sarcoplasm. Muscle cells are characterized by the presence of specialized endoplasmic reticulum which is called sarcoplasmic reticulum.
Muscle cells exhibit contractility and extensibility. The ability of muscle cells to shorten their length forcibly in response to a stimulus is their contractility. Muscle fibers have the ability to extend and shorten themselves.
Extension and contraction of muscle fibers are responsible for the movement of the human body and its parts.
Muscles are attached to bones via tendons which in turn are the fibrous connective tissues. Muscles are also part of our joints where they assist in the movement by pulling the bones as well as stabilize and strengthen the joints.
Explanation:
BB=Brown as both are big B's
Bb=Brown as there is a big B
bb=Blue as both are little b's
This is referring to electronegativity!
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
