Answer:
axial skeleton and appendicular skeleton
NOT EXACT DEFINITION: Diseases that can be passed from one living organism to the other. Two examples are flu and several STIs (such as herpes). Sorry I couldn’t think of any more :)
The events of inspiration begins with the;
Impulses are conducted on the phrenic nerve to muscle fibers in the diaphragm contracting them.
As the dome shaped diaphragm moves downward the thoracic cavity expands.
At the same time the external intercostal muscles may contract raising the ribs and expanding the thoracic cavity further.
The intra-alveolar pressure decreases
Atmospheric pressure greater than intra-alveolar pressure forces the air into the respiratory tract through the air passages.
The lungs fill with air.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
