B) The enzyme has active sites where the substrate binds with the enzyme to form a complex. When the substrate binds to the active site, an induced fit is formed where the enzyme changes its shape in order to better serve the substrate and lower the activation energy of the reaction
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
cells from which all other cells with specialized functions are generated.
Explanation:
they may be used by dividing into two or more cells called the daughter cells
Well the offspring of the original cell are considered daughter cells (as they all reproduce) so with the knowledge I know when the cell doubles it’s going to look exactly like the mother cell and not just look but they all have the same job, which is to multiple. So I think that might be the answer. But if it’s multiple choice then I might be wrong because you didn’t provide any options.
Same base pairs !! Adenine;Guanine;Cytosine;Thymine !!
