During the sixteenth and seventeenth centuries, Spaniards tried to explain the exercise of Aztec painting via the lens of the EU art concept. Their rhetoric and iconography, which constructed a distorted view of painting in Aztec Mexico, potentially tell us less about that practice than it does about the anxieties and expectancies of individuals who produced those texts and photographs. As students have recommended, the art of portrayal might also have furnished a domain for touch and compatibility among Aztecs and Spaniards.
Whilst Aztec emperor, Montezuma had a well-known disagreement with Spanish conquistador Hernán Cortés. He initially welcomed Cortés but, while unable to shop for him off, laid a entice in Tenochtitlán. Cortés, but, took Montezuma prisoner, hoping to prevent an Aztec attack.
When Moctezuma went to fulfill them at Huitzillan, he bestowed gifts on Cortes he gave him flora, put necklaces on him hung garlands around him, and put wreaths on his head. Then he laid out before him, the golden necklaces, all of his items for the Spaniards.
Learn more about Moctezuma and Cortes here:-brainly.com/question/6711918
#SPJ9
I believe it is true, I think what your asking is related to the United Nations
Option B is right that the to encourage people to settle in the colonies was the purpose of the Headright system.
Began in 1618 at Jamestown in Virginia, the Headright system was a method of granting the land legally. This system was created to attract immigrants and it was an attempt to solve scarcity of labor in Virginia, caused by the appearance of the tobacco economy. The Headrights were awarded to anyone who would agree to pay the shipping costs of the labor or slave. accordingly, colonists who were living in Virginia were given with two Headrights, and the migrated Colonists were awarded one Headright and the individuals received one Headright every time they paid for the journey of another individual. Plantation owners benefited from the Headright system when they met for the transportation of imported slaves. The increasing money amount required to bring bound slaves to the colonies and this contributed to the shift towards slavery in the colonies.
Ooiiuuytrrrwwassssssdddfffffffggggghhhhhhkkkllllmmnnbbvvcccz