Answer:
xerophytes is a species of plant that has adaptations to survive in an environment with little liquid water such as a desert,ice or snow covered region.
examples are; pineapple and gymnosperm plants.
Answer:
Crossing over is termed as a process by which genetic materials are exchanged by non-sister chromatids during meiosis. Crossing over results in the new combination of information in genetic for, the cell for a specific trait. It ensures that organisms are identical from one generation to another.
Explanation:
Since this is movement that is occurring against the natural movement from high to low concentration, this is Active transport.
The option C.
D. Parasitic will be you answer.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.