1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Helga [31]
3 years ago
7

Factor 27a^3 b^9+8c^18

Mathematics
1 answer:
Artemon [7]3 years ago
7 0

Answer:

(3ab^3+2c^6)(9a^2b^6-6ab^3c^6+4c^12)

Step-by-step explanation:

Given:

Polynomial 27a^3 b^9+8c^18

Factoring the given polynomial

27a^3b^9 can be written as

=3^3.a^3.b^3^3

=(3ab^3)^3

Also 8c^18 can be written as

=2^3.c^6^3

=(2c^6)^3

Hence Polynomial 27a^3 b^9+8c^18 can be written as

=(3ab^3)^3+(2c^6)^3

Applying sum of cubes formula i.e. a^3 + b^3=(a+b)(a^2 – ab + b^2)

=(3ab^3+2c^6)(9a^2b^6-6ab^3c^6+4c^12) !

You might be interested in
The ratio of the number of boys to the number of girls in a choir is 5 to 4. There are 60 girls in the choir. How many boys are
Ira Lisetskai [31]

Answer:

75

Step-by-step explanation:

for every 5 boys there are 4 girls

60 / 4 = 15

15 * 5 = 75

8 0
3 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
2 years ago
What are the solutions of the equation 6x2 +5x+1 = 0 ?
STatiana [176]

Answer:

Step-by-step explanation:

6x^2+5x+1=0

Descr= b^2-4ac

Descr= 25-24=1

X1= (-b+√descr)/2a = (-5+1)/12= -1/3

X2= (-b-√descr)/2a = (-5-1)/12= -1/2

6 0
3 years ago
Read 2 more answers
According to the text, which is not a main component of drawing?
julia-pushkina [17]
I think it's horizon
3 0
3 years ago
AD = 4, BC = 5, AB + DC = 12. Найти AB, DC, AC.
Black_prince [1.1K]

Answer:

Im sorry but I ain't smart for this stuff

Step-by-step explanation:

lol

6 0
3 years ago
Other questions:
  • A nurse is making identical first aid bags for patients using 72 antiseptic wipes, 55 adhesive bandages, and 36 packets of ointm
    13·1 answer
  • 20 POINTS PLEASE HELP Given: A = {(2, 3), (5, 1), (-3, -2), (0, 3)} What is the domain of A?
    6·1 answer
  • How do you solve this
    7·1 answer
  • A new family has moved in next door. You know the family has two children. What is the probability that both children are boys?
    13·1 answer
  • <img src="https://tex.z-dn.net/?f=%20%5Cfrac%7Bz%7D%7B3%7D%2B4%3D%20%5Cfrac%7B5%7D%7B6%7D%20" id="TexFormula1" title=" \frac{z}{
    12·2 answers
  • What are the solutions to log Subscript 6 Baseline (x squared + 8) = 1 + log Subscript 6 Baseline (x)
    5·1 answer
  • Does the equation represent a direct variation? If so, find the constant of variation.
    12·1 answer
  • A submarine was at the surface of the water. 21 seconds later, it was at a depth of 294 meters. What was the average change in t
    5·1 answer
  • What is perpendicular to x=5
    15·1 answer
  • Will give brainliest
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!