<h2>The answer is </h2>
False
<h2>Explanation:</h2>
According to Sigmund Freud human consciousness have been divided into three levels of awareness: the conscious, precociousness, and unconscious. These stages are never understood by any person at the same time. There is always a transition period between these segments. For example the transition stage from wake to sleep where we see a gradual reduction in consciousness with fuzzy, halfway states in between conscious and unconscious.
This is an example of; evolution
Evolution is a gradual process in which the characteristics of a species are changed in response to its environment over several generations. Evolution depends on the process of natural selection. Some of the changed characteristics (traits) may be beneficial to the organism and it can be transferred to their offspring.
Answer:
Lymphedema
Explanation:
Lymphedema is a condition formed when there is a lymphatic obstruction and excess fluids collects in tissues causing a swelling(edema)
Postoperatively, blood pressure should be obtained from the right arm, and the client's left arm and hand should be elevated so that there is no lymphatic obstruction in a patient undergoing modified radical mastectomy for breast cancer.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is E.They retain water to prevent flooding and erosion.
Explanation:
Rain forests are used to be very dense forests where lots of raining takes place. The forest floor can soak up lots of rain and during flood dense forest with woodland trees do not allow water to run fast through them thereby reducing flood's effect significantly.
The roots of the trees in the forest binds to the soil on the floor and prevent soil erosion during flooding. Study shows that water retention is more in summer than in winters. Forest can store lots of water and transfer it to the streams which is helpful in providing clean water to the people in dry season.
Therefore, the correct answer is E. They retain water to prevent flooding and erosion.
