1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Murrr4er [49]
3 years ago
5

You decide to designate the twist allele as FT to distinguish it from the forked allele F. Using the following allele symbols, i

dentify the genotypes of the three F2 classes in Part C by dragging one label to each class. Labels can be used once, more than once, or not at all.

Biology
1 answer:
Alja [10]3 years ago
4 0

Image attached

Answer:

FTFT, F, FFT (in order left to right)

Explanation:

The twist allele is FT, the forked allele is F. We are told there are pure lines, so this means they are homozygous. That means the parents are FF x FTFT.

The F1 generation is both twisted and forked (as can be seen from the image), suggesting the alleles are codominant (both are expressed).

In the F2, there are three different types of flowers, 2 matching the parental and 1 matching the F1 twisted, forked, and both.

The order from left to right is twisted, forked both. We know twisted is the genotype FTFT, and forked is the genotype FF. The both phenotype would have a copy of each allele, so would be FFT

You might be interested in
Technology and the Changing Earth: Tutorial
devlian [24]

Answer:

a device for collecting and measuring rain as it falls

5 0
2 years ago
Read 2 more answers
Which phrases describe radioactive elements? Check all that apply.
svp [43]

A radioactive element is an element which is subject to spontaneous degeneration of its nucleus followed by the emission of alpha, beta and gamma particles. All elements with atomic numbers greater than 83 are radioactive.

The given phrases that describe radioactive elements are-

They have a consistent number of particles - the particles are alpha, beta and gamma particles.

They have a half-life that determines their rate of decay.

Explanation for other options:

Not all elements occur in nature. Radioactive decay rates may not be constant as the decay happens when a radioactive substance emits a particle. It is not possible to predict exactly when a given atom of a substance will emit a particular particle. When the radioactive element release energy and particles, it decays.

5 0
3 years ago
Read 2 more answers
Since 1990, at least thirty new emergent human diseases have been identified. These include avian influenza, West
Snezhnost [94]

Answer:

2 per year

Explanation:

8 0
3 years ago
If worldwide deforestation is not regulated, what could most likely result? *
UNO [17]

B. CO2 levels in the atmosphere could increase and contribute to global warming problems.

3 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • A mutation in a G-protein prevents the alpha-subunit from dissociating from the beta/gamma-subunit. What effect will this have o
    6·1 answer
  • How did Galileo's father influence his interest in scientific experimentation?
    15·1 answer
  • Which is one of the bases found in RNA?
    9·1 answer
  • Means "pairing" of chromatids.
    8·1 answer
  • 9. What questions might scientists ask to help them understand how to develop new
    11·1 answer
  • in this food web what is represented by the chains of arrows from the grass to the foxes , hawks and snakes ?
    6·2 answers
  • A researcher found that the wild species of almond trees contains a chemical called amygdalin.
    6·1 answer
  • Genes are specific sections of?​
    13·2 answers
  • I need help labeling these
    10·1 answer
  • How has the change in the human population over time affected the environment
    10·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!