Answer:
a device for collecting and measuring rain as it falls
A radioactive element is an element which is subject to spontaneous degeneration of its nucleus followed by the emission of alpha, beta and gamma particles. All elements with atomic numbers greater than 83 are radioactive.
The given phrases that describe radioactive elements are-
They have a consistent number of particles
- the particles are alpha, beta and gamma particles.
They have a half-life that determines their rate of decay.
Explanation for other options:
Not all elements occur in nature. Radioactive decay rates may not be constant as the decay happens when a radioactive substance emits a particle. It is not possible to predict exactly when a given atom of a substance will emit a particular particle. When the radioactive element release energy and particles, it decays.
B. CO2 levels in the atmosphere could increase and contribute to global warming problems.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.