<span>All of their skulls were fairly long with sharp teeth.</span>
1) B
(I'm not so sure of this one) All of the other options have a steady impact on population regardless of the density of organisms except competition
2) D
Increased carbon dioxide levels would not hinder plant growth, and tsunamis aren't really linked to carbon dioxide levels. Increased carbon dioxide is unlikely to lower the air temperature so only D is left.
3) A
4) Three properties of water that allow it to sustain life are that it is adhesive, it is a good solvent, and cohesion. Adhesion is important in situations such as water travelling up xylem tubes in plants so that the water is not pulled down by gravity and can reach parts of the plant that need water. Cohesion allows the water being pulled up the xylem to stay together and for water molecules to be pulled when a neighbouring one is moved. Water being a good solvent allows inorganic minerals to be taken with water through vascular tissue, such as in the previous example.
2 <span>different allele combinations would be found in the gametes produced by a pea plant who’s genotype was RrYY</span>
Answer:
animals will use sound, colors, and stance. Another way would be by leaving their imprint or mark on their territory. For example a dog peeing on an area they used.
Explanation:
Hope this helps!! :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
