Answer:
as humans population continues to grow, we're cutting down more trees and occupying more lands to suffice the need of citizens, therefore, decreasing the forest biodiversity. Our plastic bags, as well as wastes, are polluting the ocean and eradicating essential species that are required to sustain a balance ecosystem, therefore, decreasing the biodiversity of the ocean that are required to maintain a balance environment.
<span>Complete the sentence below by selecting the correct words from the drop-down menus.
There are three requirements for natural selection. The requirements are </span><span>✔ variationsimilarity</span><span>, <span>underpopulation✔ overpopulation</span><span>, and <span>✔ adaptationextinction</span><span>.</span></span></span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The correct answer is Form Utility.
Form Utility refers to the action wherein the appearance of the product is increased by the seller for it to be more appealing to the consumers. based on the given situation, Courtney's Gourmet Cupcakes are made from various ingredients that when they are mixed together they are created into a new product which is a cupcake.
