The correct answer is: the short half-life of edrophonium makes it impractical for long-term.
Edrophonium is used for the diagnostic of myasthenia gravis. In patient with myasthenia gravis, the body produces autoantibodies which inhibit nicotinic acetylcholine receptors in the neuromuscular junction. Edrophonium, on the other hand, is acetylcholinesterase inhibitor which blocks the effect of acetylcholinesterase enzymes (AcH stays in synaptic cleft).
Substitution for the edrophonium is pyridostigmine which is also acetylcholinesterase inhibitor but with long-term maintenance.
Inside of plants, there are xylem cells that carry water and minerals from the roots, to the leaves, when the food then gets dispersed to the rest of the plant. This is similar to the human circulatory system but there isn't a heart pumping blood around. Hope this helps :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
D
Explanation:
Most of the energy in the United States comes from the burning of fossil fuels (coal, oil, natural gas). Hope this helps!
Answer:
D
Largest value minus the smallest value
Explanation:
The range of a set of data is the difference between the highest and lowest values in the set. To find the range, first order the data from least to greatest. Then subtract the smallest value from the largest value in the set.
