1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
What is virtual water? Why does it matter?<br><br> - How can you reduce your virtual water impact?
nika2105 [10]

Answer: What is virtual water?  

Virtual water is the volume of water used to produce consumer products. The total volume of water refers to all of the water used in the production of a product. For example, the total volume of water used in a food product would include the water used in the agricultural process, but also the water used in packaging and shipping. Virtual water is essentially all of the “hidden” water behind a product. Every product we consume contains virtual water.

Why should we care?

The majority of the public is unaware of just how much water we consume in our daily lives. It is easy to over-consume, especially when we don’t know just how much we are actually consuming. Without understanding our consumption, it is unlikely that we will succeed in reducing our virtual water footprint. Communities and countries around the world face water issues of scarcity, sustainability, sanitation and accessibility.

Food is the main source of virtual water consumption. In fact, the average American consumes about 33,000 glasses of virtual water every day. These numbers are only expected to increase with increasing populations. Understanding virtual water is a key consideration for sustainable water management.

Explanation: Water covers 70.9 percent of the planet’s surface.

97 per cent of the that water is salt water.

Around the world, 2.1 billion people still lack access to safe water.

Water use is growing at twice the rate of population growth. Unless this trend is reversed and we come up with a way to share water fairly and sustainably throughout the planet, two-thirds of the global population will face water “stress” by 2025

In the USA, the average water footprint per year per capita is as much as the water needed to fill an Olympic swimming pool, an average of 7,786 litres of water per person per day.

In China, the average water footprint is 2,934 litres of water per person per day.

In the Netherlands, 95 per cent of the water footprint of consumption lies somewhere else in the world (due to the amount of imported goods consumed), whereas in India and Paraguay only 3 per cent of the national water footprint of consumption is external.

It requires around 1500 litres of water to produce 1 kilogram of wheat, and a huge 10 times more to produce the same amount of beef.

The water footprint of a cup of coffee is around 140 litres, a cup of tea only around 34 litres.

<em>      Hope i helped</em>

6 0
3 years ago
CAN SOMEONE PLEASE PLEASE HELP ME WITH THIS!!!
Greeley [361]

Answer:

renewable A carbon diooxide B any living thing C clay D water

non renewable all i know is geosphere and its fossil fuels

Explanation:

6 0
3 years ago
Which of the following is not microscopic description of neurons:
AysviL [449]

Answer:

Star-shaped.

Explanation:

Neurons are the nerve cell that acts as the basic structural unit of the nervous system. Neurons helps in the transmission of nerve impulse and transmit the signal into different parts of the body.

There are basically four types of microscopic neuron : unipolar, bipolar, multipolar and pseuounipolar neuron. Star-shaped neurons are not found in the microscopic description of neuron.

Thus, the correct answer is option (a).  

7 0
3 years ago
Read 2 more answers
How can diabetes be controlled?
Black_prince [1.1K]

Answer:

Diabetes can be controlled with insulin, medication, exercise and other things.

Explanation:

<3 Hopefully this helps! ^^

7 0
2 years ago
A woman who has sickle cell anemia passes this disease on to her offspring. This means the mutation for sickle cell anemia MUST
kirill [66]

Answer:

gametes

Explanation:

For any mutations to be passed down to offspring, they must occur or be present in the gametes. This is because gametes are the cells that fuse to make a zygote that develops into an organism. Somatic mutations are not transferable.

7 0
3 years ago
Other questions:
  • I don't think this is a good question,but
    11·1 answer
  • What is a question that might be investigated by an environmntal scientist
    10·2 answers
  • What was the cell theory discovered through?
    13·1 answer
  • Cellulose belongs to a group of molecules called what
    8·1 answer
  • How does heat flow inside Earth move the tectonic plates?
    15·1 answer
  • A new microorganism has been isolated from hot springs in Yellowstone National Park. It consists of single cells, which appear t
    13·2 answers
  • Write the equation for the complete oxidation of glucose in aerobic respiration.
    11·1 answer
  • For which of the following pairs does the molecule given as the first term on the left contribute to the synthesis of
    12·1 answer
  • Pls help I need help ASAP THANK YOU​
    11·1 answer
  • Which of the following best describes a
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!