1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
Your friend is a pioneer in ES cell research. In her research, she uses an ES cell line that originated from an inbred strain of
Nezavi [6.7K]

Answer:

Explanation:

a)Organ transplantation requires that the donor organism and recipient be genetically close so that the graft or transplant will not be attacked by the immune system of the recipient leading to rejection and damage. Squeaky is likely to be made up of a different genetic configuration compared to laboratory inbred FG426 mouse

b) ips (induced pluripotent stem cell) on the other hand can benefit squeaky since the cells are somatic cells such as B cells, Keratinocytes, neuronal progenitors cells, kidney and muscles gotten from the donor that are reprogrammed by reactivating silent genes through fusing of another different cell such as ES (embryonic stem cell) and introduction of some transcriptional factors such oct4, sox2,kf4, and k-myc leading to transcriptional activity and DNA methylation.  This induced pluripotent stem cells can be grown into organ that can be transplanted to the recipient who was initially the donor of the reprogrammed somatic cells. Because it is from the host, the transplanted organ is not likely to trigger immune response compare to those grown from ES from other bred.

4 0
3 years ago
Which of the following happens because of mitosis? (Check all that apply)
Nataly [62]

Answer:

1,2

Explanation:

During mitosis, a eukaryotic cell undergoes a carefully coordinated nuclear division that results in the formation of two genetically identical daughter cells. ... Then, at a critical point during interphase (called the S phase), the cell duplicates its chromosomes and ensures its systems are ready for cell division.

6 0
3 years ago
Which statement about sexual reproduction in flowering plants is true
asambeis [7]

Answer:

D) Asexual reproduction produces offspring that are genetically identical to the parent.

Explanation:

I am honestly not quite sure of this answer, but I was trying to read up on the topic and this is the answer I'm most confident in. It would make sense that the offspring are genetically identical to the parent because they would have no where else to get their genes/mix to form new ones. I really hope this helps!

5 0
3 years ago
A bond of the following elements would be of what type? Drawing a model may be helpful.
Tresset [83]

The answer is ionic :)

7 0
3 years ago
Read 2 more answers
To which kingdom does this species mostly likely belong?
Varvara68 [4.7K]

Answer:

Animal kindom

Explanation:

the species most likely belong to the animal kindom

5 0
3 years ago
Other questions:
  • True or false Sepals are found at the tops of the stamen.
    10·2 answers
  • 3. Sarah, who has a mass of 55 kg, is riding in a car at 20 m/s. She sees a cat crossing the street and slams on the brakes! Her
    11·2 answers
  • A new drug is discovered for the treatment of thyroid cancer. which is logical next step of the scientific method after the disc
    15·2 answers
  • scientists compares DNA from living organisms to identify? A.) a fossil’s location. B.) naturally selection. C.) geographic isol
    8·1 answer
  • How could researcher on how genes control traits in orchids benefit our understanding of the human genome
    6·2 answers
  • True or False we can understand why we see natural resources like copper and gold where they are because we understand under whi
    11·1 answer
  • Karyotypes can be studied to determine an organism’s chromosomal makeup and to detect genetic defects. Patau syndrome occurs whe
    13·1 answer
  • Please help ASAP!!!! will give brainlsit :))
    12·1 answer
  • What process increases genetic variation
    12·1 answer
  • What would happen to digestion if our liver is removed or damaged?​
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!