1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
Why does having a genetically diverse population make a species more likely to survive a change to the environment?
Eddi Din [679]
Genetic adaptability is very important to the survival and adaptability of any specie. This is because, in a diverse population, the possibility of finding individuals with the right genetic adaptability to the changing environment is higher, the population will have more possible adaptations. 
4 0
4 years ago
Read 2 more answers
Which scientists won the Nobel Prize for publishing the first description of the structure of DNA?
gladu [14]
The scientists that won the Nobel Prize for publishing the first description of the structure of DNA were Watson & Crick.

8 0
3 years ago
The average life span of an erythrocyte in the circulation is
Nataliya [291]

approximately 115 days

Human red blood cells (RBC), after differentiating from erythroblasts in the bone marrow, are released into the blood and survive in the circulation for approximately 115 days.

3 0
3 years ago
During which phase in erythrocyte development does the color of hemoglobin overcome the color of the stained ribosomes?
Sphinxa [80]

Answer:

The correct answer is - phase 2.

Explanation:

Erythropoiesis or the development of the erythrocytes is the process to which the development of the  erythrocyte cells from the bone marrow to the mature RBC. The development of these cells involved the three phases.

During second phase involves the differentiation of the precursors of the three different type of erythrocytes that are polychromatophilic, proerythroblasts, and orthochromatic erythroblasts. It also includes building up the color of the hemoglobin that overwhelms the color of ribosomes that is blue color.

Thus, the correct answer is - phase 2.

7 0
3 years ago
Which group of Eukarya has complicated the phylogenetics of the domain by first being thought of as ancient as compared to the m
Dmitriy789 [7]

Answer:

arches bacteria hope this helps

6 0
3 years ago
Other questions:
  • REALLY NEED HELP
    7·1 answer
  • How long would it take to travel to the moon by rocket??
    10·1 answer
  • What is binary fission?
    9·2 answers
  • 1. Respiration begins with ____________. 2. Gas exchange is needed to provide cells with the ____________ they need for cellular
    5·1 answer
  • In this project, you will make a graphic to help you understand who the producers and consumers are. You can make your graphic i
    11·1 answer
  • Match the various types of intrusive rock.​
    12·1 answer
  • An organic substance that promotes chemical change without being used up in the reaction itself ​
    11·1 answer
  • Which diseases would individuals have the greatest difficulty preventing in themselves?
    10·1 answer
  • Explain the process that takes place in the stroma including the reactants going in in the products prop do used from these proc
    12·1 answer
  • You are examining a human blood smear under the microscope and note a large cell with a bilobed nucleus and orange-red granules
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!