1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
Streptococcus pneumoniae can escape phagocytic clearance by which mechanism
Stells [14]
<span>he Streptococcus pneumoniae capsule is vital for virulence and may inhibit complement activity and phagocytosis. However, there are only limited data on the mechanisms by which the capsule affects complement and the consequences for S. pneumoniae interactions with phagocytes. Using unencapsulated serotype 2 and 4 S. pneumoniae mutants, we have confirmed that the capsule has several effects on complement activity. The capsule impaired bacterial opsonization with C3b/iC3b by both the alternative and classical complement pathways and also inhibited conversion of C3b bound to the bacterial surface to iC3b. There was increased binding of the classical pathway mediators immunoglobulin G (IgG) and C-reactive protein (CRP) to unencapsulated S. pneumoniae, indicating that the capsule could inhibit classical pathway complement activity by masking antibody recognition of subcapsular antigens, as well as by inhibiting CRP binding. Cleavage of serum IgG by the enzyme IdeS reduced C3b/iC3b deposition on all of the strains, but there were still marked increases in C3b/iC3b deposition on unencapsulated TIGR4 and D39 strains compared to encapsulated strains, suggesting that the capsule inhibits both IgG-mediated and IgG-independent complement activity against S. pneumoniae. Unencapsulated strains were more susceptible to neutrophil phagocytosis after incubation in normal serum, normal serum treated with IdeS, complement-deficient serum, and complement-deficient serum treated with IdeS or in buffer alone, suggesting that the capsule inhibits phagocytosis mediated by FcÎł receptors, complement receptors, and nonopsonic receptors. Overall, these data show that the S. pneumoniae capsule affects multiple aspects of complement- and neutrophil-mediated immunity, resulting in a profound inhibition of opsonophagocytosis.</span>
6 0
4 years ago
What is sublimatoin
WINSTONCH [101]
A sublimation is a type of phase transition, or a change in a state of matter, just like melting, freezing, and evaporation.
8 0
4 years ago
Read 2 more answers
What does the presence of fossil coral, sponges, shellfish and trilobites indicate about the past climate of the Grand Canyon ar
mario62 [17]
The presence of sea-dwelling organism fossils indicate that, at one time, the area was under water.
3 0
2 years ago
Which of the following statements best describes the major difference between anaphase of mitosis and anaphase I of meiosis?
Katena32 [7]
The correct answer of the question above is the first statement. In anaphase I, homologous pairs are separated but sister chromatids stay joined together. It is <span>best statement that describes the major difference between anaphase of mitosis and anaphase I of meiosis.</span>
8 0
3 years ago
Choose all answers that apply
Novosadov [1.4K]
1st one 2nd one and i believe 3rd one
7 0
3 years ago
Read 2 more answers
Other questions:
  • 3. What types of cells does the cell theory apply to?
    13·2 answers
  • Small masses of neuron cell bodies located outside the cns are called?
    8·1 answer
  • Which is the main function of fruit?
    15·1 answer
  • Antibiotics are an effective treatment for a viral disease such as measles. true or false?
    13·1 answer
  • What is the Definition of life?
    15·2 answers
  • Which of Newton's Laws is represented in the picture below? please help!!!
    5·2 answers
  • What kind of cell is produced during meiosis? What does this determine about the number of chromosomes present in each cell?
    13·1 answer
  • Which of the following is not an input of glycolysis?
    9·1 answer
  • Which object made up of one or more smaller unit objects would make the best model for a group of cells from a plant?
    5·2 answers
  • Does this graph show an endothermic of exothermic reaction?
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!