1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
What characteristic of water causes it to display these properties: adhesion, cohesion, surface tension, and capillary action?
Nat2105 [25]

Answer:Capillary action

Explanation: it sticky, thanks to the forces of cohesion water molecules like to stay close together.

3 0
3 years ago
This squirrel lives in a forest and eats only acorns. What will most likely happen to the squirrel if the oak trees in this fore
adoni [48]
This squirrel lives in a forest and eats only acorns. <span>The squirrel will starve if it can't find enough food. </span>
6 0
3 years ago
Read 2 more answers
Two students are working together on an experiment that measures the effect of different liquid fertilizers on the thickness of
Georgia [21]

The correct answer is option (C) One student measures liquids for the experiment by holding the flask up at eye level. The other student measures liquids for the experiment while the flask sits on the table. Measuring liquids by holding the flask at eye level is the greatest amount of error in the experiment.

When liquid is being measured in a flask, the liquid shows a curve downwards which is called the meniscus. For measuring the transparent liquids, the lower meniscus touching the graduation of the should be considered and for measuring the colored liquids, the upper meniscus touching the graduation of the flask should be considered. When, the measurement is done by holding the flask at eye level there is always an error as it should be kept on a flat surface and measured by eyes directly leveling with the liquid. This gives a correct measurement which was done by the other student. Thus, one student measuring the liquid by holding the flask at eye level will have a wrong measurement and the other student measuring the liquid while the flask sits on the table gives the correct measurement and the results of the experiment will vary.


3 0
3 years ago
Read 2 more answers
What is self correction in science
notsponge [240]

Answer:correcting yourself

Explanation: they key to that question is “self correction” it’s when you find your mistake and correct it

7 0
3 years ago
6. How is a cell membrane similar to the dialysis tubing used in this experiment?
NNADVOKAT [17]
The dialysis tubing and cell membrane are similar in the fact they protect the cell. The tubing as well as cellmembranes are selectively permeable, they control the movement of substances in and out of the cell. Starch molecules are larger than glucose molecules.
3 0
4 years ago
Read 2 more answers
Other questions:
  • 4. In humans, to have long lashes is dominant to short lashes. What is the outcome for a
    15·1 answer
  • Select three changes that are examples of physical change.
    12·2 answers
  • Can you help me it’s science and i will give you a branlist
    8·1 answer
  • A population of 20 squirrels, with 10 males and 10 females, colonizes a new area with no predators and enough plant species to s
    11·1 answer
  • What is the likely reason that bees and wasps become extinct
    7·1 answer
  • The image below shows the process of DNA replication. Identify the components of the process.
    8·1 answer
  • 34. A parent cell with 24 chromosomes enters meiosis. Which type of cell is
    5·1 answer
  • Look at the model at right. On the lines provided, name the parts that are missing.
    10·2 answers
  • Water has several properties that make it unique amongst compounds and make it possible for all forms of known life to function.
    5·1 answer
  • environmental and sow-related factors affecting the duration of farrowing. animal reproduction science, 119(1-2),
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!