1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
Select all that apply. Which animals have an endoskeleton? monkeys fish starfish grasshopper clam gecko
vazorg [7]
<span>All the animals mentioned [monkey, fish, star fish, clam gecko] have endoskeleton except grasshopper which has exoskeleton. Endoskeleton is an internalised skeleton which is found inside the body of the animals which possess it while exoskeleton is a type of skeleton that is found outside the body.</span>
3 0
3 years ago
Read 2 more answers
Please help me i have testtttt rnnn
dybincka [34]

Answer:

have different strength .......

5 0
2 years ago
Who is Carolus Linnaeus <br> Need a brief explanation
Pavel [41]

Answer:

Carolus Linnaeus, also called Carl Linnaeus, Swedish Carl von Linné, (born May 23, 1707, Råshult, Småland, Sweden—died January 10, 1778, Uppsala), Swedish naturalist and explorer who was the first to frame principles for defining natural genera and species of organisms and to create a uniform system for naming them

6 0
3 years ago
Explain why algae swim up from the bottom of a pond during an afternoon
Effectus [21]

Explanation:

What happens during daytime is, oxygen that gets trapped between filaments of algae, moves them to the surface  and during night as O2 is not produced, they slowly sink to lower depths, and you don't see them

6 0
2 years ago
Which of the following phrases defines the genetic term "locus"? (A) A Gene (B) a specific place on a chromosome where a particu
Mnenie [13.5K]
B. a specific place on a chromosome where a particular gene resides.

A locus (plural loci) in genetics is the position of a gene on a chromosome. Each chromosome carries many genes; humans' estimated 'haploid' protein coding genes are 19,000-20,000, on the 23 different chromosomes. A variant of the similar DNA sequence located at a given locus is called an allele.
7 0
3 years ago
Other questions:
  • What hormone functions both as a flight or fight response and as a neruotransmitter, sending messages from one neuron to the oth
    9·1 answer
  • How does hemodialysis work?
    12·1 answer
  • Adaptation of spermatozoon
    7·1 answer
  • Explain the connection between CONVECTION and WIND in our atmosphere (4-6 sentences!!)
    13·1 answer
  • According to this food web, which of the following would be considered secondary consumers?
    8·1 answer
  • What energy yield (in molecules of ATPATP per molecule of monosaccharide) would you predict for the bacterial catabolism of raff
    14·1 answer
  • How is the environment affected by a large-scale oil spill?
    11·1 answer
  • Складіть ланцюги живлення, починаючи з продуцентів і закінчуючи редуцентами:
    6·1 answer
  • Blood type A person marries a blood type B person, both are heterozygous for the trait, what could their offspring be?
    13·1 answer
  • Compare and contrast plant-like and animal-like protists.
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!