1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
katovenus [111]
3 years ago
15

4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y

our answer. FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT 4b) How did you know how long to make the helix? Explain. 4c) What lead you to pick the region you did? Explain your answer.
Biology
1 answer:
arlik [135]3 years ago
7 0

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

You might be interested in
In cell division one difference between animals and plants is that plant cells have a
ExtremeBDS [4]
Plant cells have cell walls while animal cells don't
6 0
3 years ago
Read 2 more answers
All life must maintain an internal balance, despite environmental changes. This is called _____.
Alik [6]
The answer would be <span>homeostasis. </span>
8 0
2 years ago
A new strain of rice was developed to be resistant to popular weed killers. What could be a negative outcome from the production
asambeis [7]
B. Because of Farm laws that require no seeds to be kept from a harvest, or you are not allowed to have plants of a different genetic make or made by a different company in your field if you didn't buy it, you could have wind carry seeds into opposing fields, and if inspected, you would potentially have to pay a fine for having unauthorized varieties growing in your field. And trying to remove it would be a pain, because you would either have to find a killer that your plants are resistant to, or to find these individually and pluck them, or to spray a killer that would kill all of your plants, but none of these resistant varieties
7 0
3 years ago
Read 2 more answers
Infectious diseases have an easier time spreading now than they did several hundred years ago. What about society has changed th
d1i1m1o1n [39]

Answer:

see below :)

Explanation:

Infectious are more easily spread nowadays becuse of an increased population. The more the population increases, the bigger the advantage an infectious disease has. As of right now, because everyone is wearing masks, their immune systems are being weakened. Another reason for this is because of the increase in chemicals in our foods, which are now being transferred to our bodies. All of the medications people are taking also have an affect on the spread of disease; it gives diseases a chance to mutate.

8 0
2 years ago
Read 2 more answers
What natural resource is renewable​
tiny-mole [99]

Answer:Renewable resources include biomass energy (such as ethanol), hydro-power, geothermal power, wind energy, and solar energy. Biomass refers to organic material from plants or animals. This includes wood, sewage, and ethanol (which comes from corn or other plants).

So a natural resource would be trees because wood comes from trees.

Hope this helps

plz mark brainliest

8 0
2 years ago
Read 2 more answers
Other questions:
  • A family has a Y-linked disease that affects the father. What is the chance of a male offspring inheriting the same disease?
    5·1 answer
  • Which of the following would NOT characterize allopatric selection?
    14·2 answers
  • The name given to the adult stem cell is
    9·1 answer
  • Open the site in your browser and play the podcast. Think about whether you believe the information presented or whether you hav
    14·1 answer
  • Horticulturists are attempting to breed a rare and beautiful variety of pine tree, where all the branches droop gracefully to th
    15·1 answer
  • ‼️‼️‼️‼️‼️
    12·2 answers
  • The chemical reaction between solid copper (Cu) and silver nitrate (AgNO3) is shown below:
    8·1 answer
  • What the difference between a sabot slug and rifled slug?.
    11·1 answer
  • How long does sweetened condensed milk last in the fridge?.
    12·1 answer
  • A person has two genes, A and B that are on the same chromosome and 25cM apart, what percentage of their gametes would you expec
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!