Answer: C. Gravel
Gravel has the highest permeability.
The best description of chromosomes by the end of metaphase 2 of meiosis is that they are lined up in the middle of the cell. You can help remember this by thinking of the "M" in metaphase as middle. this is because in this phase the chromosomes are lined up in the middle of the cell.
The answer is concentration gradient. Have a good day.
Prophase is the right answer
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
