Answer:
<em>The total amount of energy transferred during photosynthesis for this ecosystem equals</em><em> 260,000 kcal/m2/yr.</em>
Explanation:
To answer this question, we need to know that
- gross primary productivity (GPP) = energy captured and converted into chemical energy during photosynthesis
- net primary productivity (NPP) = difference between GPP and respiration rate
So, to calculate GPP we need to sum NPP to Respiration rate. This if,
NPP = 165,000 kcal/m2/yr
R = 95,000 kcal/m2/yr
NPP = GPP – Respiration
Then,
GPP = NPP + R
GPP = 165,000 kcal/m2/yr + 95,000 kcal/m2/yr
GPP = 260,000 kcal/m2/yr
Answer:
he topography of Nepal is quiet diverse. We have himalayas, hills and the terai. So topography, ethinicity, resources,language had been the bases of division of a country of the federal sturucture.
Explanation:
i hope this helps! :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
