1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
tamaranim1 [39]
3 years ago
5

Wrapped up figurative language

English
1 answer:
DaniilM [7]3 years ago
7 0

Answer:

kinda

Explanation:

amosc 2eifjdweijffffffffffffffffffffffffffffffffwijisdjcivivheivhichirhienvdcinrqwfnciwdmkvfbgt'rfejqbrhmtuj6k54y53r3fqecvgbnmhjr,

You might be interested in
Which event in the play best parallels the practice of colonization
juin [17]

Answer:Not enough info

Explanation: Please provide choices and I will explain.

4 0
3 years ago
Read 2 more answers
How did Otto persecute Christoffels? He talked down to Christoffels. He allowed Christoffels to enter a room before him. He loan
siniylev [52]

Answer:

The answers:

He talked down to Christoffels.

He ridiculed and called Christoffels names.

Explanation:

This is in relation to a story in the book "The Hiding Place" authored by Corrie Ten Boom. This story is a biography on Boom's life during the war in Holland.

Otto was a young German who was also a Nazist. He was as an apprentice to Boom's father, who is a watchmaker. When Otto becomes an apprentice under Boom's Father, the family realized the effect of Nazism as Otto proudly often states that he was in the Hitler Youth, and excuses himself during daily scripture reading saying the father is reading the old testament, a "book of Jews" and consists of lies.

At a point in the story, Otto started abusing Christoffel, an old man who also works at the watch shop. Christoffel was always subjected to Otto's violence such that he is being talked down to and ridiculed by him. Sometimes, Otto also trip and hit Christoffel alongside shoving him into a wall. These were some of the ways Otto persecuted and abused Christoffels.

6 0
3 years ago
What is the longest word in the world the 3 hour one if you can answer it i will give brainlest
kompoz [17]

Answer: methionylthreonylthreonylglutaminylarginyl...

Explanation: it goes on and on and on

5 0
3 years ago
Read 2 more answers
The leaves of growing plant are usually green.<br>Fact or Opinion?​
ZanzabumX [31]

Answer:

Fact

Explanation:

sana makatulong

6 0
2 years ago
Does the sentence state a fact or an opinion? Glaciers may look still, but these huge masses of compact ice are actually flowing
myrzilka [38]

Answer:

This statement is a fact.

Reasoning:

This statement is true.

Hope this helps, and good luck!

7 0
2 years ago
Other questions:
  • 8.Which of the statements below best describes a motif in literature?
    15·1 answer
  • What statement correctly describes Andrea's view on boys in "Homesick" and gives the best supporting evidence?
    11·1 answer
  • Owls have very large eyes. These eyes help them see when it is dark outside. Their large eyes can take in what little light
    6·2 answers
  • Which statement best describes what Monna asks of Federigo?
    8·1 answer
  • In "The Highwayman," what does the highwayman do when he first hears the gunshot?
    10·2 answers
  • The play trifles is set in ​
    14·2 answers
  • "Sympathy" FINAL analytical paragraph
    15·1 answer
  • Please help me. What is the denotation (or definition) of American History ?
    9·1 answer
  • Because of the subject of this passage, the author uses words that are
    15·2 answers
  • I NEED HELP ASAP!!!
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!