<span>The correct answer for this question would be the S phase of the cell cycle. During the S phase, DNA is synthesised in the form of a complete copy, which is stored in the nucleus, as well as acting as a copy for a microtubule-organising structure referred to as the centrosome.</span>
Answer:
the answer is the 1st one
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Tying the legs and wings of poultry against the body to make a compact unit for cooking is called trussing.
The purpose of this is even cooking an a more attractive appearance.
