Answer:
u r a pickle the dramatics
Natural selection doesn't favor traits that are somehow inherently superior. Instead, it favors traits that are beneficial (that is, help an organism survive and reproduce more effectively than its peers) in a specific environment. Traits that are helpful in one environment might actually be harmful in another.
(one again, I hope this helps ^^)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
It is called hydrosphere
It is the total water in Earth.
