Answer:
Hyperinflation is a term to describe rapid, excessive, and out-of-control general price increases in an economy.
Explanation:
Answer:
Communicate with one another by means of solvent variables.
Explanation:
Numerous microbes are known to coordinate their pleasant activities and physiological techniques through a framework called majority detecting in which bacterial cells talk with each other by releasing, detecting and responding to minimal diffuse-able banner particles. The limit of microscopic organisms to give and carry on as a get-together for social correspondences like a multi-cell animal has given basic favorable circumstances to microbes in have colonization, plan of bio-films, guard against contenders, and acclimation to developing circumstances. Basically, various QS-controlled activities have been related with the hurtfulness and pathogenic capacity of microscopic organisms
Answer:
Sex linked is a trait in which a gene is located on a sex chromosome. In humans, the term generally refers to traits that are influenced by genes on the X chromosome. This is because the X chromosome is large and contains many more genes than the smaller Y chromosome.
Ex: hemophilia
hope this helps
have a good day :)
Explanation:
A mathematical model of a food web helps you better understand portions, and track the structure of how the web is flowing. The food web could also help because it helps predict things.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
