Answer:
The energy comes from electrons produced by oxidation of biological molecules.
Explanation: In photosynthesis, the energy comes from the light of the sun.
Hope this helped! :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>Due to DNA and Organelle
Duplication that takes place during Interphase within a cell, during the
splitting of a cell in Mitosis, the two daughter cells should have the exact
same genetic and physical composition as the Parent Cell. so the daughter genetic make u p is also AaSs</span>
Answer:
electromagnet: A magnet made of an insulated wire coiled around an iron core (or any magnetic material such as iron, steel, nickel, cobalt) with electric current flowing through it to produce magnetism.
Explanation:
I HOPE IT WILL HELP YOU?:-)
