Nerves that detect deep pressure are called Pacinian corpuscles.
Pacinian corpuscles are microscopic onion-shaped nerve structures that are situated in the dermis and hypodermis. Pacinian corpuscles detect deep pressure and vibration. This nerve has a myelinated nerve ending in the middle of its structure and the external layer contains flattened cells, a lymph-like fluid and collagen fibers. The structure of pacinian corpuscles provides a fast response and rapid recovery by transmitting fast events. This make them sensitive to pressure and vibration.
"D is correct answer." The statements are true it's necessary to continued to stretch from during the game. Getting the blood moving through your muscles prepares them for physical activity. Joints can be warmed up through stretching. "Hope this helps!" "Have a great day!" "Thank you for posting your questions!"
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Correct answer: B). Shelter wood cutting takes place over several years
Shelterwood cutting is the progressively cutting of the forest, in order to establish the growth of the new generation of the seedlings of a particular species without planting.
It is a method of natural tree reproduction under the shelter of old trees, which are removed successively by cutting the tree in order to provide the increased amount of light to the new seedlings. It is a slow process and takes lot of time.
Answer:
Explanation:
Most electrical wire is covered in a rubber or plastic coating called insulation. ... The purpose of insulation covering the metal part of an electrical wire is to prevent accidental contact with other conductors of electricity, which might result in an unintentional electric current through those other conductors.
