1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
mariarad [96]
3 years ago
12

What is the exact value of sin(75°)?

Mathematics
2 answers:
vladimir1956 [14]3 years ago
7 0

Answer:

D.)

Step-by-step explanation:

Edge

Fynjy0 [20]3 years ago
6 0

Step-by-step explanation:

sin 75°: Now using the formula for the sine of the sum of 2 angles, sin(A + B) = sin A cos B + cos A sin B, we can find the sine of (45° + 30°) to give sine of 75 degrees.

You might be interested in
Help ASAP! will give brainliest!
Illusion [34]

Answer:

KON

Step-by-step explanation:

8 0
2 years ago
<img src="https://tex.z-dn.net/?f=If%20w%3D2x%2C%20then%20%5Cint%5Climits%5E2_0%20%7Bf%282x%29%7D%20%5C%2C%20dx%20%3D" id="TexFo
elena-14-01-66 [18.8K]
First, you should solve for f(2x), which equals 2*(2x)=4x.  Now, solve the integral of f(2x)=2*(2x)=4x, to get that\int\ {(f(2x)=4x)} \, dx= 2x^2.  You can check this by taking the integral of what you got.  Now by the Fundamental Theorem\int\limits^2_0 {4x} \, dx=[2x^2] ^{2}_{0}=2(2)^{2}-2(0)^2=8.

This should be the answer to your question, if I understood what you were asking correctly. 
8 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
2 years ago
Read 2 more answers
What is the factored form of x^2 - 196 ?
Luba_88 [7]
D. (x-14)(x+14)
a negative and a positive multiplied makes a negative outcome so -14•+14=-196. x•x is = to x^2
8 0
3 years ago
Read 2 more answers
Write the number in exponent form
In-s [12.5K]

3. The Correct Answer is \frac{-2^2}{-6^3}


4. The Correct Answer Is \left(3^2\right)\left(-5^{\:2}\right)

7 0
3 years ago
Other questions:
  • 0.04 is 1/10 0f what
    10·2 answers
  • Let D = {x| x is a student} be the domain, and let ƒ(x) = “date of birth” be the possible function. Determine if the relation is
    10·1 answer
  • John has a spinner with eight equal sectors with labels from 1 to 8. he spins the spinner once. what is the probability that he
    14·2 answers
  • What is the value of x? enter in the box.​
    15·2 answers
  • F(x) =2x-5 and g(x) =x+52 find f(g(x)
    5·2 answers
  • Please anybody help me ASAP
    6·1 answer
  • Solve for all values of c in simplest form.<br> |4-c| = 7
    5·2 answers
  • Helpppppppppppppppp
    11·1 answer
  • Heyo can i get help?
    7·2 answers
  • Match each function formula with the corresponding transformation of the
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!