Which two fields make up electromagnetic waves?

Biology

1 answer:

Dmitrij [34]3 years ago

8 0

Answer:

All electromagnetic fields (EM waves) consist of two component fields, electric fields (E fields) and magnetic fields (H fields). E fields and H fields are companions and together make up the total EM field. Where one is, so is the other

Explanation:

Your welcome ! Let me know if you need a better explanation.

You might be interested in

What biome is Mexico City

neonofarm [45]

Answer:

Tropical Deciduous Forest

Explanation:

6 0

4 years ago

Read 2 more answers

The suprachiasmatic nuclei enable the nervous system to respond to daily light/dark alterations through their stimulation of

timama [110]

Answer:

The suprachiasmatic nuclei enable the nervous system to respond to daily light/dark alterations through their stimulation of melatonin.

Explanation:

Melatonin is a hormone produced naturally by the body. Its function is to regulate the body's circadian cycle. This hormone is stimulated and begins to act by changing between a light environment and a dark environment. This stimulation interacts with the suprachiasmatic nuclei making the nervous system understand this change and luminosity of the environment and respond to the action of melatonin.

8 0

3 years ago

Which organism is the producer in this food web? 7th grade question.

zheka24 [161]

The answer would be D plants.

They are producers because they create their own food

4 0

4 years ago

Read 2 more answers

A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi

Digiron [165]

Answer:

Explanation:

ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.

4 0

3 years ago

Who is Cynthia and how does Santha Rama Rau feel about her?

Oxana [17]

Answer:

santha and cynthia are the same person

how does Santha feel abt "Cynthia"?

detached, uninterested

She feels as if Cynthia is a whole other person.

4 0

3 years ago