Answer:
Hepatitis A infection can be prevented by getting vaccine or immune globulin soon after coming into contact with the virus. Persons who have recently been exposed to HAV should get immune globulin or vaccine as soon as possible, but not more than 2 weeks after the last exposure.
Explanation:
You can take steps to reduce the risk of passing hepatitis A to others.
Avoid sexual activity. Avoid all sexual activity if you have hepatitis A.
Wash your hands thoroughly after using the toilet and changing diapers.
Don't prepare food for others while you're actively infected.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
