1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Ray Of Light [21]
2 years ago
14

How would an error during mitosis cause a different effect on the body than an

Biology
1 answer:
Amiraneli [1.4K]2 years ago
5 0
Mistakes during mitosis lead to the production of daughter cells with too many or too few chromosomes, a feature known as aneuploidy. Nearly all aneuploidies that arise due to mistakes in meiosis or during early embryonic development are lethal, with the notable exception of trisomy 21 in humans.
You might be interested in
The major systems of the body interact with each other to maintain homeostasis. Which statement best describes how the circulato
professor190 [17]

Answer:

The endocrine system produces hormones that are transported to the target regions by the circulatory system. The Circulatory System delivers oxygen and nutrients in the blood to the surrounding cells to maintain Homeostasis. The blood in the Circulatory System is needed throughout the body so that other systems work properly. Like for instance the Nervous System has the brain, and the brain needs blood to function.

hope this helps

3 0
4 years ago
Can someone please tell me what bug this is?
viva [34]

Answer:

kinda looks like a cricket or grasshopper prob a cricket tho

Explanation:

5 0
4 years ago
When a certain plant is without water for an extended period of time, guard cells close openings in the leaves of the plant, con
kozerog [31]

Answer:

Xerophyte

Explanation:

The plant will have adventitious roots and long tap root to search for water. It will also have thick bark. Or succulent stem or leaves for storing water.

4 0
3 years ago
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
A planarian, the flatworm seen here, has the unique ability to
zaharov [31]
The answer is: d) regenerate
7 0
3 years ago
Read 2 more answers
Other questions:
  • FITT stands for frequency, intensity, time, and type
    13·2 answers
  • Naturally occurring compounds in the earth are called what?
    8·1 answer
  • What types of organisms are
    14·1 answer
  • I need answers for 5 and 6 please
    10·1 answer
  • What happens during exhalation ?
    6·1 answer
  • What do bacteria have in common with cells of other living organisms?
    11·2 answers
  • Some cells produce and secrete high levels of digestive proteins. Which organelles would you expect to be abundant in those cell
    11·1 answer
  • What is a difference between a waxing crescent and a waning gibbous
    5·2 answers
  • 1. You are given a number of mixtures. Which of the choices below would be a heterogeneous mixture?
    6·2 answers
  • Where must an mRNA attach before protein production can begin?
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!