Answer:
The answer is DNA replication and crossing over.
Explanation:
Both meiosis and mitosis are reproduction processes taking place in humans. But there is some difference between these two processes. In meiosis, parent cell produces four daughter cells which are not identical to each other.
In meiosis, when DNA replicates it produces four haploid daughter cells in which the number of chromosomes in half. Moreover crossing over and separation of chromosomes also occurs to produce sperms and egg cells. While in mitosis crossing over and DNA replication is absent.
Answer: transpiration
Explanation:
when water leaves from trees or shrubs its called transpiration
Ethanol has been shown to slow down the body's use of fat for fuel by as much as a third, causing more fat to be stored. (or 33%)
God bless!
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
