The highly organized system of neurones which generate and convey signals in the form of electronic impulses.~
Adjusted balance method calculates interest using the balance at thef a billing cycle, adjusted by anymade during the period.
Answer: b. Muscles
A metazoa is a division of animal kingdom that includes all animals expect protozoa and sponges. Metazoa division includes multicelluar animals, which exhibit highly differentiated cells. They have muscular and nerve system and well coordinated tissues and organs. Locomotion requires a coordination activity of muscular, skeletal and neural system. It is mainly achieved by contraction and relaxation of muscles that occurs due to specialized muscle proteins named as actin and myosin which receives signals from nerves.
Hence, locomotion in metazoa is due to contraction of muscles.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
