1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
lozanna [386]
2 years ago
10

Any help? question in the photo.

Biology
1 answer:
BartSMP [9]2 years ago
5 0

Answer:

The lymphatic system is a combination of circurlatory and immune systems

Explanation:

yw :))

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Give me another real-life example for each type of symbiotic relationship<br>​
olga55 [171]

Answer:

Mutualism: both partners benefit. An example of mutualism is the relationship between the Egyptian plover and the crocodile. In the tropical regions of Africa, the crocodile lies with its mouth open. The plover flies into its mouth and feeds on bits of decaying meat stuck in the crocodile’s teeth. The crocodile does not eat the plover. Instead, he appreciates the dental work. The plover eats a meal and the crocodile gets his teeth cleaned. Coincidentally, the Egyptian plover is also known as the crocodile bird.

Commensalism: only one species benefits while the other is neither helped nor harmed. For example, remora fish are very bony and have a dorsal fin (the fin on the back of fish) that acts like a suction cup. Remora fish use this fin to attach themselves to whales, sharks, or rays and eat the scraps their hosts leave behind. The remora fish gets a meal, while its host gets nothing. Selfish, sure, but neither gets hurt.

Parasitism: One organism (the parasite) gains, while the other (the host) suffers. The deer tick is a parasite. It attaches to a warmblooded animal and feeds on its blood. Ticks need blood at every stage of their life cycle. They also carry Lyme disease, an illness that can cause joint damage, heart complications, and kidney problems. The tick benefits from eating the animal's blood. Unfortunately, the animal suffers from the loss of blood and nutrients and may get sick.

Explanation:

3 0
3 years ago
What is the lap report of an animal cell
nexus9112 [7]

The Cell, the fundamental structural unit of all living organisms. Some cells are complete organisms, such as the unicellular bacteria and protozoa, others, such as nerve, liver, and muscle cells, are specialized components of multicellular organisms. In another words, without cells we wouldn't be able to live or function correctly.

8 0
3 years ago
Wuyssey Quiz
kari74 [83]

OC

Explanation:

I guess I just know it

4 0
3 years ago
Which of these is most likely to cause noise pollution
irina [24]

Answer:

rock concert

Explanation:

3 0
3 years ago
Read 2 more answers
Other questions:
  • Taxonomy is an organizing science used in _____.<br> 8<br> zoology<br> botany<br> all of these
    9·2 answers
  • Unfortunately, you go a bit overboard and feel a sudden pinch, after which you notice you are bleeding. What has happened? Are y
    7·2 answers
  • Jared received a head injury at work and later had trouble speaking and planning ahead. Which are of his brain was most likely d
    10·1 answer
  • Place the steps of the respiration process in the correct order.
    6·2 answers
  • Which of the following does NOT accurately describes a typical human karyotype?
    13·2 answers
  • Pls answer these questions​
    10·2 answers
  • The mouse population would most likely decrease if there were?
    12·1 answer
  • I NEED HELP!
    6·1 answer
  • Free p o i n t s here you go
    14·1 answer
  • A) What are the bases of mRNA coded for by this section of DNA, before the
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!