Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
 
        
             
        
        
        
Answer:
Mutualism: both partners benefit. An example of mutualism is the relationship between the Egyptian plover and the crocodile. In the tropical regions of Africa, the crocodile lies with its mouth open. The plover flies into its mouth and feeds on bits of decaying meat stuck in the crocodile’s teeth. The crocodile does not eat the plover. Instead, he appreciates the dental work. The plover eats a meal and the crocodile gets his teeth cleaned. Coincidentally, the Egyptian plover is also known as the crocodile bird.
Commensalism: only one species benefits while the other is neither helped nor harmed. For example, remora fish are very bony and have a dorsal fin (the fin on the back of fish) that acts like a suction cup. Remora fish use this fin to attach themselves to whales, sharks, or rays and eat the scraps their hosts leave behind. The remora fish gets a meal, while its host gets nothing. Selfish, sure, but neither gets hurt.
Parasitism: One organism (the parasite) gains, while the other (the host) suffers. The deer tick is a parasite. It attaches to a warmblooded animal and feeds on its blood. Ticks need blood at every stage of their life cycle. They also carry Lyme disease, an illness that can cause joint damage, heart complications, and kidney problems. The tick benefits from eating the animal's blood. Unfortunately, the animal suffers from the loss of blood and nutrients and may get sick.
Explanation:
 
        
             
        
        
        
The Cell, the fundamental structural unit of all living organisms. Some cells are complete organisms, such as the unicellular bacteria and protozoa, others, such as nerve, liver, and muscle cells, are specialized components of multicellular organisms. In another words, without cells we wouldn't be able to live or function correctly.