Answer:
Commenting so you can give the other dude Brainliest. answer is correct :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The human cells will lose totipotency
about 4 days after fertilization. The fertilized egg creates a single
totipotent cell called a zygote. The
zygote divides into identical totipotent cells. Approximately about 4 days, the
totipotent cells begin to specialize and becomes pluripotent.
Answer:
Scientific Methodology involves the following procedures of
-observing and making enquires,
-formulating inferences and developing hypotheses,
-performing controlled experiments,
-gathering and evaluating data,
-and coming into conclusions.
